Protein Info for MPMX19_00741 in Azospirillum sp. SherDot2

Annotation: Phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 257 to 274 (18 residues), see Phobius details PF02504: FA_synthesis" amino acids 5 to 328 (324 residues), 362.5 bits, see alignment E=9.9e-113 TIGR00182: fatty acid/phospholipid synthesis protein PlsX" amino acids 6 to 336 (331 residues), 316.8 bits, see alignment E=8.6e-99

Best Hits

Swiss-Prot: 73% identical to PLSX_RHOCS: Phosphate acyltransferase (plsX) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 97% identity to azl:AZL_010230)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>MPMX19_00741 Phosphate acyltransferase (Azospirillum sp. SherDot2)
MSQRLTIALDAMGGDHGPDMVIAGADIARERHPDVRFLLYGDQQRLEPLLNQRPALKAVA
EIRHTADFVAGDAKPAVALRAGRQSSMRLAIDAVAAGEAACVVSAGNTGALMAMAKFVLK
TLPGIDRPAMASFFPTQRGESVMLDLGANAECQPENLVQFAVMGAVFARAILGLPQPSIG
VLNIGSEDMKGNEVVRAAAASLRDMPLPGRFHGFVEGTDIGLGTVDVIVTDGFTGNVALK
TAEGTAKLFSEFLRRTFATSFLARIGYLLARGAFKRFRERIDPRRYNGAMFLGLRGVCVK
SHGGTDAVGFANAVAVAINLATHGFNERIKEEMGRIADATPLPDTKAAAG