Protein Info for MPMX19_00734 in Azospirillum sp. SherDot2

Annotation: Riboflavin biosynthesis protein RibBA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 12 to 205 (194 residues), 232.1 bits, see alignment E=2.3e-73 PF00926: DHBP_synthase" amino acids 13 to 204 (192 residues), 280.7 bits, see alignment E=4.9e-88 PF00925: GTP_cyclohydro2" amino acids 217 to 366 (150 residues), 134.4 bits, see alignment E=2.9e-43

Best Hits

Swiss-Prot: 47% identical to RIBBA_BREBN: Riboflavin biosynthesis protein RibBA (ribBA) from Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)

KEGG orthology group: K14652, 3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC: 3.5.4.25 4.1.99.12] (inferred from 97% identity to azl:AZL_010160)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25, 4.1.99.12

Use Curated BLAST to search for 3.5.4.25 or 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>MPMX19_00734 Riboflavin biosynthesis protein RibBA (Azospirillum sp. SherDot2)
MTSEFHHYLSTAEEIIEEARQGRMFILVDDEDRENEGDLVIPASCATPDAVNFMAKHGRG
LICLTMDRPNIERLRLPLMAQQNASRHQTAFTVSIEAREGVTTGISAADRARTIAVAIDP
ASGPHDLATPGHIFPLLARDGGVLVRAGHTEASVDIARLSGHSSSAVICEIMNDDGTMAR
LPDLVQFAQFHGLKVGTIADLIAYRRRTETIVEQVLAGNLDSRYGGRFQSYVYINKIQYA
EHIALVRGDISGDEPVLVRMHAQSVLDDVLGDRNSGRDNDLHASMELIAKEGRGVVVLLR
EPNPNGLSTVLKARLEGQAGSVPELRDYGIGAQILLDLGVRKMTLISNRKKPIIGLEGYG
LTVVGHRAINPGAADPGED