Protein Info for MPMX19_00726 in Azospirillum sp. SherDot2

Annotation: Putative sugar phosphate isomerase YwlF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02502: LacAB_rpiB
  • amino acids 6 to 144 (139 residues), 195.7 bits, E=1.6e-62
• TIGR00689: sugar-phosphate isomerase, RpiB/LacA/LacB family
  • amino acids 6 to 144 (139 residues), 175.9 bits, E=4.4e-56
• TIGR01120: ribose 5-phosphate isomerase B
  • amino acids 6 to 144 (139 residues), 160.4 bits, E=2.6e-51

Best Hits

Swiss-Prot: 44% identical to RPIB_ECOLI: Ribose-5-phosphate isomerase B (rpiB) from Escherichia coli (strain K12)

KEGG orthology group: K01808, ribose 5-phosphate isomerase B [EC: 5.3.1.6] (inferred from 94% identity to azl:AZL_010080)

MetaCyc: 44% identical to allose-6-phosphate isomerase / ribose-5-phosphate isomerase B (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]; 5.3.1.- [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase B (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or LMPTP YwlE cluster or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• Rubisco shunt (10/10 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• Calvin-Benson-Bassham cycle (12/13 steps found)
• Bifidobacterium shunt (13/15 steps found)
• ethene biosynthesis V (engineered) (20/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• pentose phosphate pathway (7/8 steps found)
• oxygenic photosynthesis (13/17 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• D-allose degradation (1/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (145 amino acids)

>MPMX19_00726 Putative sugar phosphate isomerase YwlF (Azospirillum sp. SherDot2)
MTVRTVALASDHAGYELKAQIARQLEGAGYTVLDLGTDGPASVDYPDFAAALAAAVTDGR
AQRGVLVCGSGIGISIAANRHPGIRAALVHDVTTARLSREHNDANVIALGARIVGPEIAK
DCVEIFLKTDFEGGERHSRRIAKMG