Protein Info for MPMX19_00705 in Azospirillum sp. SherDot2

Annotation: Cell division coordinator CpoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02795: tol-pal system protein YbgF" amino acids 158 to 273 (116 residues), 118.2 bits, see alignment E=1.6e-38 PF13432: TPR_16" amino acids 163 to 229 (67 residues), 36.4 bits, see alignment E=1.1e-12 PF13174: TPR_6" amino acids 197 to 225 (29 residues), 19 bits, see alignment (E = 3.4e-07) amino acids 233 to 264 (32 residues), 25.8 bits, see alignment 2.3e-09

Best Hits

KEGG orthology group: None (inferred from 89% identity to azl:AZL_009860)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>MPMX19_00705 Cell division coordinator CpoB (Azospirillum sp. SherDot2)
MTNIRPVAALLLGGMLAATPALAQSKGQIERLQSLEMQVAALGGPVEVAQLSPSVAADFE
IRLQNLERTIQDLTGKYEESSYQVTQLRERLEKVNSDVDFRLKELEKGGGTAGGAMGGAM
SDAAPAKPSKAAASDDKKADKPAQTAAANPPSTAGLSPEKQYEQAFELLRNSDYDRAEKA
LQEFIVKNKSHAYAGNAQYWLGESYYVRNKFPEAAQAFAEVLSKYRTNPKAADSLLKLGM
TLQQMNKKSDACTAFGQLLTKFPEASASVKRRADTERKRINCPA