Protein Info for MPMX19_00699 in Azospirillum sp. SherDot2

Annotation: Acyl-CoA thioesterase YbgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02799: tol-pal system-associated acyl-CoA thioesterase
  • amino acids 20 to 147 (128 residues), 143.2 bits, E=5e-46
• TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family
  • amino acids 23 to 130 (108 residues), 101.4 bits, E=4.1e-33
• PF13279: 4HBT_2
  • amino acids 29 to 148 (120 residues), 63.2 bits, E=3.3e-21
• PF03061: 4HBT
  • amino acids 34 to 121 (88 residues), 52.1 bits, E=7e-18

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 90% identity to azl:AZL_009800)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (162 amino acids)

>MPMX19_00699 Acyl-CoA thioesterase YbgC (Azospirillum sp. SherDot2)
MSDASTPSSLSGRFAEDGTHRYPLRVYYEDTDAGGIVYHANYLRFAERARTEMLYLMGFR
QREMAEGLGDVTGVSFAVRRLTIDFDAPAKLEDTLEVETRIVDIRGASFALAQVIRRDGR
VLARADLQLVTINRAGRAVRLPEPVKAAMETLHAKQNASSPA