Protein Info for MPMX19_00672 in Azospirillum sp. SherDot2

Annotation: putative zinc protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF00675: Peptidase_M16" amino acids 14 to 160 (147 residues), 146.3 bits, see alignment E=6.4e-47 PF05193: Peptidase_M16_C" amino acids 168 to 339 (172 residues), 143.5 bits, see alignment E=6.9e-46

Best Hits

Swiss-Prot: 39% identical to Y338_RICFE: Uncharacterized zinc protease RF_0338 (RF_0338) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: None (inferred from 96% identity to azl:AZL_009540)

Predicted SEED Role

"Mitochondrial processing peptidase-like protein (EC 3.4.24.64)" in subsystem ZZ gjo need homes (EC 3.4.24.64)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>MPMX19_00672 putative zinc protease (Azospirillum sp. SherDot2)
MSSIRVTTLPNGLRVATDTMPDVQSVSLGCWVGVGTRNEAASVNGVAHLVEHMLFKGTSR
RSAFRISEEIENVGGQLNAYTTREQTAYYAKVLHEDAPLALDILSDMIQHSTLDAEELVR
ERTVVLQEIGQSADTPDDIIFDHFQSTAYPGQAIGRPVLGSAEIVGSLPREALVDYIAGH
YGAPGMVLSAAGRIEHDRMVDLAFKAFGDLPSGAPPKPETARYIGGDFREDRDLEQMHLV
LGFDGVGVHDPDFYAHSVLSTLLGGGMSSRLFQEVREKRGLVYSIYTFTGGYHDGGLFGV
YAGTGEDEVAELVPVVCDEIAKVGADVTEDEVARARAQLKAGTLMALESTMSRCEQLGQQ
ILIYDRPVPVDEIVAKIDGVDRESVVKAASRLRASRPTVAALGPIAKLESYDRIAERLA