Protein Info for MPMX19_00671 in Azospirillum sp. SherDot2

Annotation: Threonine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14821: Thr_synth_N
  • amino acids 2 to 80 (79 residues), 95.2 bits, E=3.1e-31
• TIGR00260: threonine synthase
  • amino acids 78 to 431 (354 residues), 268.9 bits, E=3.3e-84
• PF00291: PALP
  • amino acids 85 to 331 (247 residues), 73.8 bits, E=2.3e-24
• PF24857: THR4_C
  • amino acids 387 to 463 (77 residues), 48 bits, E=1.7e-16

Best Hits

Swiss-Prot: 62% identical to THRC_PSEAE: Threonine synthase (thrC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 97% identity to azl:AZL_009530)

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.3.1

Use Curated BLAST to search for 4.2.3.1

Protein Sequence (473 amino acids)

>MPMX19_00671 Threonine synthase (Azospirillum sp. SherDot2)
MRYVSTRGAAPVLGFEDVLLAGLARDGGLYVPETWPQFTADDIRAMRGLPYSEIAVRVML
PFLGGSIAEDEFRAIVRDAYASFDHAAVTPLVQVDPTTWVLELFHGPTLAFKDVALQLLG
RLFDHVLTKRGQRVTIVGATSGDTGSAAIEACRDRQNVDIFILHPKGRTSEVQRRQMTSV
LSSNVHNIALDGTFDDCQDLVKAMFNDGAFRDRMGLSAVNSINWARIMAQIVYYFTAAVA
LGAPDRKLAFTVPTGNFGNVYAAYGARSMGLPMETLVVGSNSNDILARFFASGSMVAAPV
VPTLSPSMDIQISSNFERLLFDLLDRDGTAVTEALNRFRTEGKFAVTDAQLARALAIFSG
HRVDEAATMATIAEVWKDSLYLLDPHTAVGIGAAKAAVAAGRVDPTVPMVVLATAHPAKF
PDAVEKATGRRPDLPPRLSDLYVREERLSDLPNDLAAVQDFVTKRARAAQEAA