Protein Info for MPMX19_00635 in Azospirillum sp. SherDot2

Annotation: 5,10-methylenetetrahydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF02219: MTHFR" amino acids 9 to 287 (279 residues), 328.1 bits, see alignment E=2.5e-102 TIGR00676: methylenetetrahydrofolate reductase [NAD(P)H]" amino acids 11 to 286 (276 residues), 355.3 bits, see alignment E=1.1e-110

Best Hits

Swiss-Prot: 56% identical to METF_NEIMB: 5,10-methylenetetrahydrofolate reductase (metF) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K00297, methylenetetrahydrofolate reductase (NADPH) [EC: 1.5.1.20] (inferred from 94% identity to azl:AZL_009190)

Predicted SEED Role

"5,10-methylenetetrahydrofolate reductase (EC 1.5.1.20)" in subsystem Methionine Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>MPMX19_00635 5,10-methylenetetrahydrofolate reductase (Azospirillum sp. SherDot2)
MTAPTSALPSISFEFFPPKSEKMEQSLWQSIRRLAPLSPSFVSVTYGAGGSTRERTHATV
CRIQDETGIPAAAHFTCVGATRDEIDAIARTYWDAGIRHLVALRGDPPETAGGVGGRYEP
FPGGYAYAADLVAGMKRIADFEISVAAYPESHPEAPNAQFDLDNLKRKVDAGATRAITQF
FFDNDAYFRFLDRCAAAGIHVPIVPGILPITNFARAVEFAGKCGASMPAKLAETFEGLDD
DPETRQLVAATVAAEQCQALQAQGVNDFHFYTLNRSDLTIAICRMLGVKAKAAPAAVAG