Protein Info for MPMX19_00634 in Azospirillum sp. SherDot2

Annotation: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF12840: HTH_20" amino acids 15 to 58 (44 residues), 32.8 bits, see alignment 3.7e-11 PF01022: HTH_5" amino acids 15 to 57 (43 residues), 41.5 bits, see alignment 6.6e-14 PF12802: MarR_2" amino acids 19 to 59 (41 residues), 36.2 bits, see alignment 3.7e-12 PF13412: HTH_24" amino acids 19 to 57 (39 residues), 24.8 bits, see alignment 8.8e-09 PF13489: Methyltransf_23" amino acids 133 to 267 (135 residues), 63.5 bits, see alignment E=1.3e-20 PF05175: MTS" amino acids 139 to 251 (113 residues), 29.8 bits, see alignment E=2.9e-10 PF01135: PCMT" amino acids 143 to 216 (74 residues), 24.8 bits, see alignment E=1.1e-08 PF01209: Ubie_methyltran" amino acids 150 to 262 (113 residues), 47.4 bits, see alignment E=1.1e-15 PF13847: Methyltransf_31" amino acids 151 to 261 (111 residues), 80.7 bits, see alignment E=5.8e-26 PF07021: MetW" amino acids 151 to 242 (92 residues), 27.7 bits, see alignment E=1.3e-09 PF13649: Methyltransf_25" amino acids 153 to 245 (93 residues), 87.3 bits, see alignment E=6e-28 PF08242: Methyltransf_12" amino acids 153 to 247 (95 residues), 64.2 bits, see alignment E=1e-20 PF08241: Methyltransf_11" amino acids 153 to 249 (97 residues), 98.1 bits, see alignment E=2.6e-31

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 94% identity to azl:AZL_009180)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>MPMX19_00634 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (Azospirillum sp. SherDot2)
MDDLLATLKAAAETTRLRLLALCAHGELTVTELTQILGQSQPRVSRHLKLLCDAGLLDRF
REGTFAFYRLAEKGQSAELARVLVDAIPADDATLILDLERLDAIKRSRSESAAAYFRENA
ARWHEIRSLHVAEGEVEAALLRLFPEEGVEELLDIGTGTGRMLEVLAGRVHRAIGVDQSR
EMLAVARNRLEEAGLRHCHVRQADMYQLPFPSGSFDAAVIHQVLHYTESPAGVLAEAARV
LRPGGLLLIVDFAPHHLEALREEHAHRRLGFSDAEVAGWCRQSGLDCGPVVQLPGDPLTV
SVWPATRLAAGAAISFPKTAHSLSGVPS