Protein Info for MPMX19_00631 in Azospirillum sp. SherDot2

Annotation: putative MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 306 to 332 (27 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 290 (280 residues), 92.9 bits, see alignment E=2e-30 amino acids 222 to 404 (183 residues), 51.6 bits, see alignment E=7.2e-18 PF12832: MFS_1_like" amino acids 12 to 374 (363 residues), 58.5 bits, see alignment E=6.5e-20

Best Hits

Swiss-Prot: 59% identical to Y2456_MYCTU: Uncharacterized MFS-type transporter Rv2456c (Rv2456c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 90% identity to azl:AZL_009150)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>MPMX19_00631 putative MFS-type transporter (Azospirillum sp. SherDot2)
MAGPNRSLDLLNFFLADVRDGLGPYLAIYLLTVQHWNEADIGLVMTLAGLAGIAAQVPAG
ALVDGTRYKRAVIVVAALLVTVGSLTLPWLNSFTVVAVLQSAVGAAGAVFPPAIAAITLG
MLGPRAFVRRVGRNESFNHAGNAVAALLAGLAAYAFGPVAVFWLMTAMALCSIAATAGIP
ANAIDHAVARGLHGGNHGGDRETPSGLRVILGCRPLLIFGGCAALFHFANAAMLPLVGQK
LAMKDPALGTSLMSFCIVAAQLVMVPMAMLVGARADRWGRKPLLLAAFLVLPVRGVLYTL
SDNSAWLVGVQLLDGVGAGLFGALFPLVVADLTEGTGRFNVSQGAIATLQGIGAALSTAA
AGQMVVREGYSAAFLMLAAAAGVALLLAALLLPETRNVGAAETGEDDMAPGDAAKAASEA