Protein Info for MPMX19_00612 in Azospirillum sp. SherDot2

Annotation: Pyridoxal kinase PdxY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to PDXY_DEIGD: Pyridoxal kinase PdxY (pdxY) from Deinococcus geothermalis (strain DSM 11300)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 93% identity to azl:AZL_008950)

MetaCyc: 46% identical to pyridoxal kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyridoxal kinase. [EC: 2.7.1.35]

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
pyridoxal 5'-phosphate salvage I (6/6 steps found)
pyridoxal 5'-phosphate salvage II (plants) (6/9 steps found)
4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MPMX19_00612 Pyridoxal kinase PdxY (Azospirillum sp. SherDot2)
MKSVLTIQSHVAYGYVGNRAAVFPLQRLGIDATAVNTVQFSNHTGYGAWTGQVFTAEHIA
DIVDGIAARGVLPAQDAVLSGYMGAVELGQVIVETAARVKAVNPKAIYCCDPVMGDVGRG
FFVRPGLPEFIRDHAVPAADLMTPNQFELEYLTDRKVATLDDALAAIAALRARGPRLVLV
TSLTRSDADPDSIEMLVDGADGAWLVSTPRLTFDPPPNGSGDAVAALFLAHYLTAFDPAD
ALEKAAAAIFAIFETTQRIGTRELQLIAAQDDFVNPPRRFSATRLR