Protein Info for MPMX19_00592 in Azospirillum sp. SherDot2

Annotation: ADP-ribosyl-[dinitrogen reductase] glycohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR02662: ADP-ribosyl-[dinitrogen reductase] hydrolase" amino acids 34 to 319 (286 residues), 498.2 bits, see alignment E=3.3e-154 PF03747: ADP_ribosyl_GH" amino acids 40 to 295 (256 residues), 186.2 bits, see alignment E=5.6e-59

Best Hits

Swiss-Prot: 63% identical to DRAG_RHORU: ADP-ribosyl-[dinitrogen reductase] glycohydrolase (draG) from Rhodospirillum rubrum

KEGG orthology group: K05521, ADP-ribosylglycohydrolase [EC: 3.2.-.-] (inferred from 94% identity to azl:AZL_007740)

Predicted SEED Role

"ADP-ribosyl-[dinitrogen reductase] glycohydrolase (EC 3.2.2.24)" (EC 3.2.2.24)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.- or 3.2.2.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>MPMX19_00592 ADP-ribosyl-[dinitrogen reductase] glycohydrolase (Azospirillum sp. SherDot2)
MRAVRGMHQEGTDPVPDRMTDPTSLTPDIRSPQIRSRALGAYLGLACGDALGATVEFLTK
GEIAHQYGVHKHIKGGGWLKLAAGQVTDDTEMSLHLGRAILSGPEWEARRAAEEFAIWLK
SVPVDVGDTTRRGIRRFIMNGTLEEPESEYHAGNGAAMRNLPVALATLGDDAAFERWSVE
QSHVTHCNQLSDSAVIALGRMVRRLVLGGGIVAAREEANALIARHRQFKFEPYRGLSTAF
IVDTVQTVFHYYFQTDSVESCVVETVNQGGDADTTGAIAGMLAGATYGVESIPPRWLRKL
DREVHDEICQQTDALLARAPLFGGK