Protein Info for MPMX19_00568 in Azospirillum sp. SherDot2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00015: MCPsignal" amino acids 243 to 399 (157 residues), 101 bits, see alignment E=3.5e-33

Best Hits

KEGG orthology group: None (inferred from 89% identity to azl:AZL_007500)

Predicted SEED Role

"InterPro IPR000104:IPR003660:IPR004089 COGs COG0840"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>MPMX19_00568 Methyl-accepting chemotaxis protein (Azospirillum sp. SherDot2)
MLAGVALAALLAADLLQMGGLALRAGLAVAGLAALGGALLYLHRAGAAVDRLTRVNRAVA
AGDFEARVIGIREGGALGELMHATNDAIDRTDAFVREATASMHAVSEHKYFRRIVLRGMQ
GGFLHASRTINAATESISQKVAGFAGVTQRFEGQIQSVCSEVADTAHRLEVSARTMETDA
TQATGKASSVAASAAQTGSNVGSVAAATEELSASIADISRQIGDVARVAETAVGEAERSN
ALVGTLSGAARTVGDVVTLINDIASQTNLLALNATIEAARAGEAGKGFAVVAQEVKRLAD
QTAKATGDIAAQISAIQSSTDEAVTSIVGIGHTIQSINRIAAGISAGIEQQGSAVREIVV
NMEQAAAGTRAVSDDIRDVTDAAGRTSGTAHEVFAASGRMAAEADRLTREVQHFLDEMHR
VA