Protein Info for MPMX19_00556 in Azospirillum sp. SherDot2

Annotation: ATP synthase subunit b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 59 to 79 (21 residues), see Phobius details PF02326: YMF19" amino acids 54 to 123 (70 residues), 40.6 bits, see alignment E=5.6e-14 PF00430: ATP-synt_B" amino acids 65 to 193 (129 residues), 72.7 bits, see alignment E=4.7e-24

Best Hits

Swiss-Prot: 53% identical to ATPF2_RHOCS: ATP synthase subunit b 2 (atpF2) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 94% identity to azl:AZL_007380)

Predicted SEED Role

"ATP synthase B' chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>MPMX19_00556 ATP synthase subunit b (Azospirillum sp. SherDot2)
MPNLLAKGRLARWSGVAGASLATLTTMAGTVLAAAAEHAPNAAHGGEHASGGLPQLNPAN
FPTQIFWLALTFGVLYYLMSKKALPRVAEVLEARQERISRDLAKAAQLKEEAEAILAQVE
KSLAGARAEAQGVIAQAAAGIEANSQARQAQLNADIAERLRTAEASIAAAKEQALANIRA
ESAGIVRDITGRLAGVDVDQAQADAAVAAVLEERRG