Protein Info for MPMX19_00554 in Azospirillum sp. SherDot2

Annotation: 4,5-DOPA dioxygenase extradiol

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02900: LigB
  • amino acids 39 to 255 (217 residues), 114.5 bits, E=2.4e-37

Best Hits

Swiss-Prot: 47% identical to DOD1U_BETVU: 4,5-DOPA dioxygenase extradiol 1 (DODA1) from Beta vulgaris

KEGG orthology group: None (inferred from 87% identity to azl:AZL_007360)

MetaCyc: 45% identical to 4,5-DOPA-dioxygenase (Portulaca grandiflora)
Stizolobate synthase. [EC: 1.13.11.29]

Predicted SEED Role

"FIG074102: hypothetical protein"

MetaCyc Pathways

• betalamic acid biosynthesis (2/3 steps found)
• superpathway of betalain biosynthesis (13/27 steps found)

KEGG Metabolic Maps

• Tyrosine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.29

Protein Sequence (267 amino acids)

>MPMX19_00554 4,5-DOPA dioxygenase extradiol (Azospirillum sp. SherDot2)
MSDTAPFPSVFVSHGAPTLILETSAGRDFLAGLGRKLGRPSAILAVSAHWTTRVPAVSGA
TAPETVHDFYGFPDELYRMRYAAPGAPALAARVAEMTDAVVDPSQGLDHGAWVPLMLMYP
EADIPVAQLSVMPYRSAADHIALGHLLEPLRRDGVLILASGGAVHNLREFRFGGNSAAPW
ATGFAGWLDRTLEAGDADAVGNWLDASPDARRAHPTDEHFLPLPVALGAAGPRPKTERLH
AGFEHGSLGMHAYAFTSAQADAEADAA