Protein Info for MPMX19_00536 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF04339: FemAB_like" amino acids 16 to 384 (369 residues), 529 bits, see alignment E=7e-163 PF13480: Acetyltransf_6" amino acids 196 to 330 (135 residues), 44 bits, see alignment E=2.6e-15

Best Hits

KEGG orthology group: K09919, hypothetical protein (inferred from 91% identity to azl:AZL_007190)

Predicted SEED Role

"FIG110192: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>MPMX19_00536 hypothetical protein (Azospirillum sp. SherDot2)
MPDGNDAITVKVLTGIDEADQQGWDACAGPGNPFLSHAFLLALEDSGSACGKSGWQPSHL
AAYDGSGRMVGAVPAYLKSHSYGEYVFDHAWANAFERAGGSYYPKLQVAVPFTPVPGPRL
LVTPGPQSEAVADALVAALEQVTERYGVSSAHVTFPERADWDRLGTAGWLQRLGVQYHWH
NRGYGSFDEFLEALNSRKRKAIRKERREVAESSVRLHTLTGDDLKPEHWDAFHRFYLETA
DRKWGGGYLNRRFFDLLGRTMADRVVLVMCEDGGDWVAGALNLLGDDALYGRNWGSDGSY
RFLHFEACYYRALDFAIERGLARVEAGAQGEHKIQRGYLPVPTYSAHWIADPSFRRAVDR
YLKQERPAVESEIDALDEELSPYRREG