Protein Info for MPMX19_00524 in Azospirillum sp. SherDot2

Annotation: Lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 16 to 169 (154 residues), 124.9 bits, see alignment E=1.5e-40 PF01252: Peptidase_A8" amino acids 23 to 165 (143 residues), 132.7 bits, see alignment E=5.7e-43

Best Hits

Swiss-Prot: 45% identical to LSPA_METNO: Lipoprotein signal peptidase (lspA) from Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 88% identity to azl:AZL_007050)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.36

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>MPMX19_00524 Lipoprotein signal peptidase (Azospirillum sp. SherDot2)
MYGHMNAFVANQSRSYWLFGLIVAVLVVVLDQGSKWWILEQVMQPVPHVIEVTPFFNLVL
VWNYGVSFGTFASGGALMPYILSAIAAVIAVCLVFWLRQAERRLIALALGFIIGGAVGNV
ADRMLHGAVVDFLDFHVGGWHFWAFNVADSGISVGVVLLLIDGLFAGREKS