Protein Info for MPMX19_00502 in Azospirillum sp. SherDot2

Annotation: NAD kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01513: NAD_kinase
  • amino acids 12 to 89 (78 residues), 26.5 bits, E=7e-10
• PF20143: NAD_kinase_C
  • amino acids 135 to 207 (73 residues), 34.5 bits, E=1.6e-12

Best Hits

Swiss-Prot: 68% identical to NADK_MAGSA: NAD kinase (nadK) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 96% identity to azl:AZL_006850)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

• cytosolic NADPH production (yeast) (4/5 steps found)
• NADP biosynthesis (1/1 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• NAD phosphorylation and transhydrogenation (1/2 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• NAD phosphorylation and dephosphorylation (1/3 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Protein Sequence (262 amino acids)

>MPMX19_00502 NAD kinase (Azospirillum sp. SherDot2)
MPAPDALRIAFSCADTDEARAARTRLVHRYGNALADEADVIVALGGDGFLLETLHRALSR
NRERPTPVYGMNRGSVGFLLNAYREEDLAERIVASQHVRLHPLRMVATRVNGERVEALGI
NEVSLLRETRQAAKLRITIDKVVRLPELICDGALVATPAGSTAYNLSAHGPIVPLNAGVL
ALTPISAFRPRRWRGALLPHTAKITFDVLEEGKRPVSAVADFTEVREVLRVEVQECREVG
LTLLFDPELNFEERILKEQFAP