Protein Info for MPMX19_00472 in Azospirillum sp. SherDot2

Annotation: Protein HesB, heterocyst

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 2 to 106 (105 residues), 124 bits, see alignment E=1.4e-40 PF01521: Fe-S_biosyn" amino acids 2 to 103 (102 residues), 79.7 bits, see alignment E=9.7e-27

Best Hits

Swiss-Prot: 52% identical to YNIU_AZOVI: Uncharacterized protein in nifU 5'region from Azotobacter vinelandii

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 92% identity to azl:AZL_006570)

Predicted SEED Role

"Iron binding protein IscA for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>MPMX19_00472 Protein HesB, heterocyst (Azospirillum sp. SherDot2)
MVTLTDAAVSTLERVLEKSGGAAAGLRIAVTDGGCAGLKYQMGLEATAGDDDTVLSFGPV
TIFVDANSQPFLSGVVVDFVEGIEGSGFKFDNPNATSSCGCGKSFSAGDGSGGSCSTSSS
GCGSSAPYSTH