Protein Info for MPMX19_00456 in Azospirillum sp. SherDot2

Annotation: Tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 15 to 319 (305 residues), 305.7 bits, E=2e-95
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 42 to 308 (267 residues), 183.2 bits, E=3.3e-58

Best Hits

Swiss-Prot: 63% identical to LPXK_RHOCS: Tetraacyldisaccharide 4'-kinase (lpxK) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 88% identity to azl:AZL_006420)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (8/9 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (12/17 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (4/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (12/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Protein Sequence (332 amino acids)

>MPMX19_00456 Tetraacyldisaccharide 4'-kinase (Azospirillum sp. SherDot2)
MKTPAFWYRPPGLASTLLAPLGAFYGLAGRRRIAGTVPRRVGVPVVCVGNLVAGGAGKTP
VGLALIAALQARGVAVHALTRGHGGREAGPLAVDPGRHTAADVGDEALLLAGAAPCWVAR
DRLAGAERSVAAGAKAIVMDDGFQNPALHKDLSLIVADGAVGFGNGRLVPAGPLRERVAD
GLARADALVILGEDRHALAELAGGLPVLAARLEPDPEAAARLVARDVLAFAGIGRPEKFF
ATLEALGARIAERVPFADHHPYRPAEVAALIDRAAALGALPVTTAKDAVRLPPELRAKIA
VLPVSVRWADEGALAALLTHVSLKGSPDGQAA