Protein Info for MPMX19_00442 in Azospirillum sp. SherDot2

Annotation: Putative transport protein YhhT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 44 to 61 (18 residues), see Phobius details amino acids 67 to 83 (17 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details amino acids 269 to 299 (31 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 341 to 368 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 50 to 373 (324 residues), 164.6 bits, see alignment E=1.7e-52

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_006280)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>MPMX19_00442 Putative transport protein YhhT (Azospirillum sp. SherDot2)
MTDRSQFASIPPAHPPAPEAPLAGTPEPATEPVPPPGHRRNPQTIATVGLFVIALLFALY
FGRDVLLPIMLALILSFLLRPLVRALYRVRVPEGIGAAIMVVSLFGGVLLAVYTLSGPAA
EWVNRMPRVMHELEFKLGDIRAGIDRAREASRQIEQITKETGNQAGPAREVVVRGPTLME
QAVSQVETVLANVVILLVLLYFFLARGRHSLEALIGTMRNVDDRVHYAMVAATLQQNIAA
YLLTITVINAILGLATGLLMWLWGLPNPALWGVMVALANYIPFIGPAVMTGVLFLVSVLT
FDGLGTIILPPLSFVALTTIEGNFLTPMIVGRRLSLNPIAVFVSILFWGWLWGIPGALLA
VPILAILKILFDAHEPLKPVGALLGD