Protein Info for MPMX19_00415 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 284 to 301 (18 residues), see Phobius details PF00892: EamA" amino acids 18 to 155 (138 residues), 53.2 bits, see alignment E=2e-18 amino acids 167 to 299 (133 residues), 72.1 bits, see alignment E=2.8e-24

Best Hits

KEGG orthology group: None (inferred from 82% identity to azl:AZL_006040)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>MPMX19_00415 hypothetical protein (Azospirillum sp. SherDot2)
MPDASAFPADHAYRTQRIALIALLVGALGIAFAPIFVRLSEVGPVATGFWRTALAMPALG
LWMAAESRQRDGRSSRRPSSVSDYARLSLAGLFFAGDLAIWHTSIRYTSVANSTLLANFA
PLYVAPAAWFLFKERITRRFVMGMLLALAGAIVLMGESFQLDADHLFGDGLALLTAAFYA
GYILSVGRLRAEFSTATIMTWSGAISALVLLPIGLYDGEAMLPASASGWAVLAGLALFSH
ACGQSLIAYALAHLPASFSSVSLLLQPAAAAILAWILLSEPLGPLQALGAAVILVGILLA
RPGGR