Protein Info for MPMX19_00346 in Azospirillum sp. SherDot2

Annotation: Trehalose-phosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00685: trehalose-phosphatase" amino acids 22 to 260 (239 residues), 169.9 bits, see alignment E=9e-54 TIGR01484: HAD hydrolase, family IIB" amino acids 26 to 220 (195 residues), 51.1 bits, see alignment E=1.8e-17 PF02358: Trehalose_PPase" amino acids 27 to 246 (220 residues), 158.2 bits, see alignment E=1e-50

Best Hits

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 55% identity to rce:RC1_1412)

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>MPMX19_00346 Trehalose-phosphate phosphatase (Azospirillum sp. SherDot2)
MTLIPPSALAEFDAFTASLDGRTPALFLDYDGTLAAIAPRPELAAMPDEARAVVQRLSAL
CPVAFVSGRDLDDLTAMVAVDGLVYAGSHGFDLRGPDLRRQVGVEYVPDLDIADGSLRDR
LGGIAGALVERKRFAIAIHTRQVAPPEKPRVADAVRAVVEAQPRLRMTGGKELFELRPNL
PWDKGRAVLALLEALGLEGNGTMPIYLGDDETDEDAFRALAGRGDGNGIGIRVMDGPAET
AAIWSLHDPAEAAAFLGRLADWLAQG