Protein Info for MPMX19_00331 in Azospirillum sp. SherDot2

Annotation: GTP-binding protein EngB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 35 to 219 (185 residues), 226.9 bits, see alignment E=1.6e-71 PF01926: MMR_HSR1" amino acids 53 to 171 (119 residues), 81.8 bits, see alignment E=1e-26 PF02421: FeoB_N" amino acids 53 to 180 (128 residues), 36.1 bits, see alignment E=1.2e-12 TIGR00231: small GTP-binding protein domain" amino acids 53 to 197 (145 residues), 48.2 bits, see alignment E=1e-16 PF00009: GTP_EFTU" amino acids 128 to 218 (91 residues), 32.4 bits, see alignment E=1.8e-11

Best Hits

Swiss-Prot: 57% identical to ENGB_RHORT: Probable GTP-binding protein EngB (engB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03978, GTP-binding protein (inferred from 93% identity to azl:AZL_005240)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>MPMX19_00331 GTP-binding protein EngB (Azospirillum sp. SherDot2)
MTSPATPTPDTPSIVSGFDEAALEAGRLLFAKECDFVWGANALNQLPEADLPEVAFAGRS
NVGKSSLVNALTGRKTLARTSNTPGRTQQLNFFNLGNRLKLVDMPGYGYAKESKEKVEAW
NDMVRRFLRGRVTLRRALVLIDSRHGMKPHDHEIMEMLDRTAVPYVVVLTKADKVKAADL
DRVRRETQAGLKKHPAAFPDIHVTSSEKGTGIAELRASLAALALGAE