Protein Info for MPMX19_00330 in Azospirillum sp. SherDot2

Annotation: Membrane protein insertase YidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 374 to 392 (19 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details amino acids 468 to 489 (22 residues), see Phobius details amino acids 527 to 544 (18 residues), see Phobius details amino acids 564 to 585 (22 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 34 to 400 (367 residues), 319.1 bits, see alignment E=5.4e-99 PF14849: YidC_periplas" amino acids 113 to 390 (278 residues), 279.3 bits, see alignment E=5.4e-87 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 401 to 599 (199 residues), 232.4 bits, see alignment E=4.7e-73 PF02096: 60KD_IMP" amino acids 402 to 599 (198 residues), 209.1 bits, see alignment E=4e-66

Best Hits

Swiss-Prot: 56% identical to YIDC_METRJ: Membrane protein insertase YidC (yidC) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 97% identity to azl:AZL_005230)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>MPMX19_00330 Membrane protein insertase YidC (Azospirillum sp. SherDot2)
MRRLPSPAKTRNKAAHTPPFFQRPHGNRDAMTDQRNLIIAIALSIAILLGFQFFYEKPRV
EQQKQLAAQQAAQTEQSVPVPAPGVPAQQPPATAEVAKERPVLLAEQLAAGTRVKIDTPA
LHGSVNLVGGRIDDLTLAQYHETPDPKSPEIVLLAPAGTPAAYYAEFGWVPQGAGIAAPT
ATTRWTADGAALTPDKPLTLTWDNGQGLVFERKIAVDPDFMFTVTQTVRNTGAAPVTLLP
YSLVSRSGTPHTSGYYILHEGPLGVFNGSLTEEKYDDVRKAGSIAKDTTGGWVGITDKYW
LVSLVPDPNEKVTARFLYNQVANTDRYQTDTMGAPVTVAPGASAENTGRLFAGAKQVKLL
DSYSEKLNIKNFDLAIDFGWFYFLTKPFFYALDFLGRIIGNFGIAILVLTVCVKAVFFPL
ANKSYQAMSKMKALQPKMQELREKFSDDQARMNQELMALYKREKVSPVSGCLPILIQIPV
FFSLYKVLFVTIEMRHAPFFGWIHDLSSPDPTTIFNLFGLIPWDPPAMLHLGLWPLIMGV
TMWFQQKMNPAPPDPIQQKVFQFLPIVFTFMLAGFPAGLVIYWAWNNTLSVLQQWTIMKR
MGVKA