Protein Info for MPMX19_00328 in Azospirillum sp. SherDot2

Annotation: Ribonuclease P protein component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 TIGR00188: ribonuclease P protein component" amino acids 10 to 105 (96 residues), 47.4 bits, see alignment E=1e-16 PF00825: Ribonuclease_P" amino acids 10 to 120 (111 residues), 80.4 bits, see alignment E=4.9e-27

Best Hits

Swiss-Prot: 39% identical to RNPA_OCHA4: Ribonuclease P protein component (rnpA) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: K03536, ribonuclease P protein component [EC: 3.1.26.5] (inferred from 95% identity to azl:AZL_005210)

Predicted SEED Role

"Ribonuclease P protein component (EC 3.1.26.5)" in subsystem tRNA processing (EC 3.1.26.5)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>MPMX19_00328 Ribonuclease P protein component (Azospirillum sp. SherDot2)
MAAPGHEVGRLMRRPEFLAVAGTRRKHVAPGLILQVRRHDDKQRPAEGGPPIRLGLTASR
KVGNAVVRNRARRRLREAARQILTVHAAPGHDFVLVARGGTAERPWTDLLGDLAAGLKRL
GLWREAEG