Protein Info for MPMX19_00314 in Azospirillum sp. SherDot2

Annotation: Succinyl-diaminopimelate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR01246: succinyl-diaminopimelate desuccinylase" amino acids 7 to 374 (368 residues), 420 bits, see alignment E=4.1e-130 PF01546: Peptidase_M20" amino acids 68 to 374 (307 residues), 150.3 bits, see alignment E=7.4e-48 PF07687: M20_dimer" amino acids 179 to 285 (107 residues), 72.2 bits, see alignment E=3.2e-24

Best Hits

Swiss-Prot: 69% identical to DAPE_RHOCS: Succinyl-diaminopimelate desuccinylase (dapE) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 97% identity to azl:AZL_005080)

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.18

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>MPMX19_00314 Succinyl-diaminopimelate desuccinylase (Azospirillum sp. SherDot2)
MTIDPVALAQDLIRCPSVTPRDDGALGVLEAALAPMGFTCHRLRFQQEGTEPVENLYARL
GTEGPNFCFAGHTDVVPPGDRGWTVDPFAGEVMGGRLFGRGAVDMKGAIAAFVAAVSRRL
EDGPPAGSISLLITGDEEGVAINGTRKVLDWLAERGERIDACVVGEPTNPKALGDMIKIG
RRGSLTGFLTVFGAQGHVAYPHLADNPLPRLVRMLAAITEHPMDEGTAHFQPSTLALTTI
DVDNTATNVIPAQGKATFNIRFNDAHTPAGIEAWLRQTFDTVGGAYELEVYCSGDSFVTP
PGPLTELVAEAVEGVTGRRPDYSTTGGTSDARFIKNVCPVVEFGLVGQTMHKVDEYCSVE
DLRQLTAIYESILKGVFTRLAG