Protein Info for MPMX19_00297 in Azospirillum sp. SherDot2

Annotation: 4-carboxy-4-hydroxy-2-oxoadipate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF03737: RraA-like" amino acids 24 to 172 (149 residues), 163 bits, see alignment E=3.2e-52

Best Hits

Swiss-Prot: 42% identical to HMGA_PSEP1: 4-hydroxy-4-methyl-2-oxoglutarate aldolase/4-carboxy-4-hydroxy-2-oxoadipate aldolase (Pput_1361) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K10218, 4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC: 4.1.3.17] (inferred from 92% identity to azl:AZL_004930)

MetaCyc: 43% identical to subunit of 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Pseudomonas putida)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]

Predicted SEED Role

"Dimethylmenaquinone methyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>MPMX19_00297 4-carboxy-4-hydroxy-2-oxoadipate aldolase (Azospirillum sp. SherDot2)
MTVHKDFARPDAATLEALRAQSPATLHEAMGKKGAMGYPIKPLFPGMRLCGPALTVSCGP
TDNLMIHIAVALAKPGDVLVVDFKGMTDAGPWGDILTASAIARGLGGLVIDGCVRDAAAI
RDMGFPVFCRGTNMKGTNKTDAKGDVNTTVVVGGVMVSPGDIVVADDDGVVVVPQGLAAD
TLAKAAAREAAEEAYRHKLEAGETTIELLNLKPYLDAANIAL