Protein Info for MPMX19_00289 in Azospirillum sp. SherDot2

Annotation: Tyrosine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 TIGR00234: tyrosine--tRNA ligase" amino acids 16 to 416 (401 residues), 335.6 bits, see alignment E=2.3e-104 PF00579: tRNA-synt_1b" amino acids 46 to 334 (289 residues), 251 bits, see alignment E=1.6e-78 PF01479: S4" amino acids 360 to 400 (41 residues), 25 bits, see alignment 1.3e-09

Best Hits

Swiss-Prot: 62% identical to SYY_RHORT: Tyrosine--tRNA ligase (tyrS) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 93% identity to azl:AZL_004860)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.1

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>MPMX19_00289 Tyrosine--tRNA ligase (Azospirillum sp. SherDot2)
MPTRSNANQSPAADFLHILRERGFLHQCSDPADDLSGLAAAAPGGALTAYVGYDATAASL
HVGHLLSIMALRWLQRTGNRPIVLIGGGTTRIGDPSFRDTSRPMLDEAQIAANAAGLRSV
FGQYLTFGDGPADAVMVDNADWLDGLDYVPFLRDVGRHFTINRMLSFESVRQRMEREQPL
TFLEFNYMILQAYDFLELSRRHGCLLQMGGSDQWGNIVNGIELARRVERRELFGLTTPLL
TTASGTKMGKTAGGAVWLNADARSPFDFWQFWRNTEDADVGRFLRLFTELPLDEIARLER
LGGAEINEAKIVLATEATRLCHGTAEAERAASAAGSPFAPGGDGLPEIALRLAEGTGGVP
LVDALVAAGLSASKGAARRLIREGGARLDGQPVTDEAATLTAPAVLSAGRKRHVRLIVTA