Protein Info for MPMX19_00270 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 225 to 259 (35 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 340 to 365 (26 residues), see Phobius details PF07885: Ion_trans_2" amino acids 283 to 363 (81 residues), 50 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 93% identity to azl:AZL_004600)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>MPMX19_00270 hypothetical protein (Azospirillum sp. SherDot2)
MFDDQIHASNRFRFYAIRSKTFGWAPAAVPALVSVYRPMDQIVPDRRPRTSSPPPAVPPG
GSHGNHGGGHAGRGASKSWLGGALLTALLLGLIALSIRSVSGDLTFVLLGSVGLVVGAFH
YLFPGSQFFTLALTNFIGVYACIFVFFAESNFHNISPLIQAIAFVLPLVAFLGGAWWRAE
DIRRIVMSRRLREGGHFDRVFLWMAPVWGIGALTFLVPEQDMDTQAIGAIFLLAMSAIAA
IVVLVSRDIAIFLLDAGLLFEGFFQQSARLVLPAFAFLTFYSLCIILFGAIYTIMDRFMA
EPNFVIEGVRRDITFAEGIYFSIVTFATVGYGDIHPVSGVVRLVCGIEIVMGVLLLLFGF
SAIIGHARPTGRSDRNDPL