Protein Info for MPMX19_00262 in Azospirillum sp. SherDot2

Annotation: Thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF05690: ThiG" amino acids 7 to 258 (252 residues), 336.2 bits, see alignment E=5.4e-105

Best Hits

Swiss-Prot: 74% identical to THIG_AZOC5: Thiazole synthase (thiG) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 98% identity to azl:AZL_004540)

MetaCyc: 48% identical to 1-deoxy-D-xylulose 5-phosphate:thiol sulfurtransferase (Escherichia coli K-12 substr. MG1655)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>MPMX19_00262 Thiazole synthase (Azospirillum sp. SherDot2)
MPTDTLTIAGRSLGSRLFLGTAGYPNQQVMLDALAASGSELVTLAIRRISLDGYSESLVD
VLARATARRPNGPVGLLPNTAGCMTAKEAVLTAQLSREALDTSWIKLEVIGDRELLYPDV
EELLRATEELVNDGFVVLPYCNDDPVTCRKLADLGAAAVMPLGAFIGSGMGIRNPHAIET
ICARSPVPVVLDAGIGTASDAALAMELGCAAVLLNTAVSKARDPVRMAAAMRDAVNAGRA
AHLAGRMPMRAHAEPSSPQMGLIGG