Protein Info for MPMX19_00260 in Azospirillum sp. SherDot2

Annotation: Hydrogen cyanide synthase subunit HcnC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details PF01266: DAO" amino acids 21 to 367 (347 residues), 250.2 bits, see alignment E=9.2e-78 TIGR02352: glycine oxidase ThiO" amino acids 21 to 372 (352 residues), 351.1 bits, see alignment E=3.3e-109 PF00890: FAD_binding_2" amino acids 21 to 228 (208 residues), 36.4 bits, see alignment E=7.4e-13 PF13450: NAD_binding_8" amino acids 23 to 51 (29 residues), 25.2 bits, see alignment (E = 3.2e-09)

Best Hits

KEGG orthology group: K03153, glycine oxidase [EC: 1.4.3.19] (inferred from 93% identity to azl:AZL_004520)

Predicted SEED Role

"Glycine oxidase ThiO (EC 1.4.3.19)" in subsystem Thiamin biosynthesis (EC 1.4.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>MPMX19_00260 Hydrogen cyanide synthase subunit HcnC (Azospirillum sp. SherDot2)
MIHAPEPHPYSVSAPGLRPSVAVIGAGCIGLAIAWRLASAGCRVDVFERGEAGRGATHAA
GGMLAACVETEPGEEGLLPLTRASQALWPDFARDLEAASGMAVDLRSEGTMVIALTADDA
AKVRFLHGFQRDLGLPVEWLNGAEVRRREPFLQPGVAGALFCAGDHQVDNRKVAAALRRA
AEAAGAHLHERCGEVALAVEGGRAVGVRLAETLHRADQVVLAAGAWSAGVPGLPPAAKPP
VRPVKGQMVCLRMDPRQPLLRHVVWTPGTYLIPRLDGRLLIGATTEERGFDDRLTAGGQF
ALLEGAWRALPGIAELPIEEAWAGFRPGSRDDAPILGESGIPGLIHATGHHRNGILLTPV
TADGIARLVLTGETDPLLRPFAADRFVAAGAAA