Protein Info for MPMX19_00258 in Azospirillum sp. SherDot2

Annotation: Protein ImuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00817: IMS" amino acids 26 to 158 (133 residues), 49.9 bits, see alignment E=3.3e-17 PF11799: IMS_C" amino acids 248 to 350 (103 residues), 31.1 bits, see alignment E=2.8e-11

Best Hits

Swiss-Prot: 46% identical to IMUB_CAUVC: Protein ImuB (imuB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K14161, protein ImuB (inferred from 85% identity to azl:AZL_003880)

Predicted SEED Role

"DNA polymerase-like protein PA0670" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>MPMX19_00258 Protein ImuB (Azospirillum sp. SherDot2)
MVRGAERTKRRILALWLPRLPTDARERLMPPEVRARPLVLLRTERQRRVVVAVNRAAAML
GIAPGHTLSDARALEPTLEAAEATPEADSALLGRIADWARRYSPWTAADEPDGVVIDLTG
CAHLFGGEPALAADLTGRLRAAGFAARAAIADTPAAAWGLVRFGSPEQRRREALDGLPLS
ALRLPAETVEGLHALGLRRIGDLHAMPRAGLAARFGAGLMQRYDQAFGRLDEPISPRRPV
PDHRERLTFAEPIATPESIAGALRHLLGRLCKGLEAAGQGARRLRLDAHRTDQRVDDEPQ
SLTLGTSRPTRDPVALARLFAPLLERIEPGPGLETLVLSATETGPLSAVQTAIDGGEAGD
QGNDDQLAELVDRLTLRLGERAVLRLVPRESWLPERCVAPHPPMERLPAPKPWPAGQPRP
LRLLTPPEPVEATAPLPDDPPLLFVWRGVPHRVRRAEGPERIECEWWRGQGSLGPAVRDY
YRVEDDGGRRFWLFRAGLYCPDETPRWFLHGFLA