Protein Info for MPMX19_00228 in Azospirillum sp. SherDot2

Annotation: Oligopeptide transport ATP-binding protein OppF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00005: ABC_tran" amino acids 23 to 168 (146 residues), 104.7 bits, see alignment E=9.7e-34 PF13401: AAA_22" amino acids 37 to 197 (161 residues), 30.2 bits, see alignment E=7.4e-11 PF13304: AAA_21" amino acids 135 to 203 (69 residues), 34 bits, see alignment E=5.1e-12

Best Hits

Swiss-Prot: 42% identical to OPPF_STRMU: Oligopeptide transport ATP-binding protein OppF (oppF) from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 91% identity to azl:AZL_003590)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>MPMX19_00228 Oligopeptide transport ATP-binding protein OppF (Azospirillum sp. SherDot2)
MMIDIQDLQVRFGRGADAITAVDGVTLAVREGESFGLVGESGSGKSTVLRAVSGLNDEWT
GRIAVAGAEQGPVRQKGFYKLCQMVFQDPYGSLHPRHTVDRILAEPIAIHGLGDANARID
RVLRDVGLGPAFRFRYPHQLSGGQRQRVAIARALVLEPRVLLLDEPTSALDVSVQAEILN
LLRRLRAEHGLTLVLVTHNLAVVANLCDRLAVMNRGRLVEEMSVEELRRGAARQPYTLQL
LRASQGYDRATAESFRDYA