Protein Info for MPMX19_00203 in Azospirillum sp. SherDot2

Annotation: Ribosomal RNA large subunit methyltransferase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 15 to 79 (65 residues), 56.9 bits, E=3.5e-19
• PF10672: Methyltrans_SAM
  • amino acids 182 to 354 (173 residues), 52.6 bits, E=1e-17
• PF03602: Cons_hypoth95
  • amino acids 225 to 309 (85 residues), 31.6 bits, E=3.2e-11
• PF05175: MTS
  • amino acids 226 to 343 (118 residues), 26 bits, E=1.7e-09
• PF13847: Methyltransf_31
  • amino acids 228 to 350 (123 residues), 31.5 bits, E=3.5e-11

Best Hits

Swiss-Prot: 35% identical to RLMI_PHOPR: Ribosomal RNA large subunit methyltransferase I (rlmI) from Photobacterium profundum (strain SS9)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 93% identity to azl:AZL_003340)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (403 amino acids)

>MPMX19_00203 Ribosomal RNA large subunit methyltransferase I (Azospirillum sp. SherDot2)
MSDTGTKPVKKYPAIHLQSGRQRRVMQGHPWVYSNEVQMDTTAKAVPPGSPVRLLDPGGT
PLGIYTFNPHTLIAARLLSSDPATVVDQAFIADRLRRAVELRDRLFSRPFYRVVHAEADG
LPGLIVDRFDDVVTVQANSVFMDRRIDEILAAIDEVMEPRAVILRNDGSQRALEGLAEET
RLAKGEIDGSIRLEENGATFFANPLDGQKTGWFYDQRDNRAFIASLAKGGRAIDFYSYNG
GFGIQCAVAGATQVIAVDRSALALENATRAAEANGVADRFEARKADAFQEMERLGTAGET
FQVVVADPPAFVKSKKDLAAGSRAYRKMARLAAKITAPGGYLLCGSCSHNVDPPAFAELV
ARGLHDAGRTGRILRSAGAGPDHPVHPHLPESAYLKALVLQLD