Protein Info for MPMX19_00185 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details PF13103: TonB_2" amino acids 193 to 249 (57 residues), 24.9 bits, see alignment E=1.9e-09 PF03544: TonB_C" amino acids 205 to 251 (47 residues), 31.7 bits, see alignment 1.7e-11 TIGR01352: TonB family C-terminal domain" amino acids 208 to 252 (45 residues), 29.1 bits, see alignment 4.9e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>MPMX19_00185 hypothetical protein (Azospirillum sp. SherDot2)
MSDLEPHRNGRIRTSDGSDSTVRWGLLFSIAIHAVVVAPLIWYCTPPVYRPPASQMDVPF
IEMVEMAQLLPETSSGASAISTSKTAAETGSLPAGEVSADMSSPEPILNAVRKPDPQPTV
DAPPSKPPRQPPVKPVPAKAARVKPMQARNNSVEQAMDVPLPLGMTGAAARTVASSFPPS
QSAKEDPNQVAIEYGRVVRSHLDKNIIYPQQDRSILMSAKAVVHFFILADGRVTDVKIVQ
SSGSDIIDRVAKST