Protein Info for MPMX19_00115 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 924 signal peptide" amino acids 1 to 74 (74 residues), see Phobius details transmembrane" amino acids 321 to 343 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 92 to 307 (216 residues), 69 bits, see alignment E=1e-22 TIGR00229: PAS domain S-box protein" amino acids 363 to 488 (126 residues), 48 bits, see alignment E=1.3e-16 PF13188: PAS_8" amino acids 366 to 405 (40 residues), 27.7 bits, see alignment (E = 5.6e-10) PF13426: PAS_9" amino acids 376 to 481 (106 residues), 31 bits, see alignment E=7.9e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 490 to 651 (162 residues), 129.5 bits, see alignment E=1e-41 PF00990: GGDEF" amino acids 494 to 649 (156 residues), 150.2 bits, see alignment E=1.3e-47 PF00563: EAL" amino acids 672 to 904 (233 residues), 251.2 bits, see alignment E=2.8e-78

Best Hits

KEGG orthology group: None (inferred from 88% identity to azl:AZL_025650)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (924 amino acids)

>MPMX19_00115 hypothetical protein (Azospirillum sp. SherDot2)
MASHACAVHDLDKGHVHVRHALSIDRSARGASMMRPKAIPMALPMAIRSARTAVSRLLAI
LLLSLLAGDPAAAINTPVPAQLPETGPRPAEIRVTLDNNYPPYSFHTPDGTHVGIVKDMW
MLWSQKTGIPVRMMPLDWGLARQAMDKGDADVIETIFRNSAREAIYDFSKPYARVDVPIW
FSADLSGITGVDSLRAFTVGVKDGDFCIEWLADQGIAAFQRYPGFEAMVDAASRQETRVF
CMDDPSARYYMTKRGVQGRFRYTEPLYTGELHWAVRKGNAALFRLIVDGFARIAPDERKA
VEERWLGRPLTGLVSPQTMDLLVKLLAGLAVLGAGALVWVLLLRRQVESKTESLRTAVTA
LTASEERVRTIFDSVNDGIVIHDLDSGAILEVNRRMREMYRVGEVPLSDIDVGMLSSGEP
PYTAAVAADWRGKAGDGEPQLIEWHARRLDGSTFWIEVSMRRAVIDGNDRRVLVLIRDIT
ERKAAQERMEYLSRHDALTLLPNRILVQDRTEQALARSERNGRLVALVACGLDRFKTVND
SLGHAVGDALLRAVADRLKAAVRETDTVSRGGGDEFILLLSGKPDIDTVVETVASLHEAM
AAPFQVGGQELTLTLSSGVAMAPADGKDFATLLKNADTALHHAKAAGRDTHRFYAEAMNA
EAVAHLSTRSGLRRALERGEFLIHYQPQISLETGAVTGAEALVRWNHPEKGMVPPGDFIP
IAEDSGLIVPIGAWVLTEACRQAAQWHAQGLPLSVAVNLSALQLQRNDLVRTVTRALADS
GLDPLLLELELTESMLIQNTDLVMDNLRRIKAMGVQVSIDDFGTGYSNLSYIGRLAVDKL
KIDRSFVADLTRNHDSAKITAAVIQMAHSLNLTAVAEGVEDAETLEALRGLHCDFAQGYF
LGRPGPAEAVERAARQVNPFRVGV