Protein Info for MPMX19_00103 in Azospirillum sp. SherDot2

Annotation: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  • amino acids 4 to 416 (413 residues), 588 bits, E=5.7e-181
• PF00364: Biotin_lipoyl
  • amino acids 4 to 75 (72 residues), 70.8 bits, E=1e-23
• PF02817: E3_binding
  • amino acids 120 to 150 (31 residues), 51 bits, see alignment (E = 2e-17)
• PF00198: 2-oxoacid_dh
  • amino acids 186 to 414 (229 residues), 288.6 bits, E=4.9e-90

Best Hits

Swiss-Prot: 61% identical to ODO2_PSEAE: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 94% identity to azl:AZL_025790)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.61

Protein Sequence (416 amino acids)

>MPMX19_00103 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (Azospirillum sp. SherDot2)
MATEIKVPTLGESVSEATVARWLKKAGEAVAMDEALVELETDKVTLEVNAPAAGVLAEIV
AAEGANVEVGALLGVLTEGAGAAAAPAAAAPAAAPAPAAAPAPAAAPAAAAPGNIAASGP
AARKLADEKGVDTSAIAGSGKDGRITKGDVIAAPVAAPAAKPAAPAPAPKVQWAAGTQGD
RPRAAQEERVRMTRLRQRIAERLKEAQNSAAMLTTFNEVDMSAAMALRAEYKDYFEKRHK
VRLGFMSFFVKAAVQALKEIPAVNAEIDGTDIVYKNYYDIGVAVGTPQGLVVPVVRNADQ
LDFAGVEGTIAALGKKGRDGKLSMDELTGGTFTISNGGVYGSLMSTPIINPPQSAILGMH
KTMDRAVVVGGKIEVRPMMYLALSYDHRIIDGKEAVTFLVRIKELIEDPRRLLLDV