Protein Info for MPMX19_00039 in Azospirillum sp. SherDot2

Annotation: Fumarylpyruvate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 26 to 226 (201 residues), 199.9 bits, E=2.1e-63

Best Hits

Swiss-Prot: 44% identical to FAHD1_ARATH: Probable acylpyruvase FAHD1, mitochondrial (FAHD1) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 95% identity to azl:AZL_026390)

MetaCyc: 60% identical to 3-fumarylpyruvate hydrolase (Bradyrhizobium sp. JS329)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetase (EC 3.7.1.2)" in subsystem Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 3.7.1.2)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• gentisate degradation I (2/3 steps found)
• 5-nitroanthranilate degradation (3/6 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)

KEGG Metabolic Maps

• Styrene degradation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.2

Use Curated BLAST to search for 3.7.1.2 or 3.7.1.20

Protein Sequence (227 amino acids)

>MPMX19_00039 Fumarylpyruvate hydrolase (Azospirillum sp. SherDot2)
MAFAIPLWSQPAVPVTGGDPFPVRRIYCVGRNYAAHAREMGADPDREPPFFFMKPADAIV
ADGATIPYPPKTANLHHEIELVVAIGTGGRDIPVDRALEHVFGYAVGLDMTRRDLQNAAK
KEGKPWDMGKGFDQSAPCSAIRTVADIGHPAKGAVTLEVNGEPRQKGDLSDLIWSVAETI
SYLSGLVELQPGDLIYTGTPEGVGAVVAGDVLTGAVEGVGTLTLTIA