Protein Info for MPMX19_00024 in Azospirillum sp. SherDot2

Annotation: 3-dehydro-bile acid delta(4,6)-reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03486: HI0933_like" amino acids 4 to 393 (390 residues), 237.2 bits, see alignment E=4.8e-74 PF01494: FAD_binding_3" amino acids 4 to 38 (35 residues), 23.2 bits, see alignment 9.9e-09 PF00890: FAD_binding_2" amino acids 4 to 37 (34 residues), 24.5 bits, see alignment 3.8e-09 TIGR00275: flavoprotein, HI0933 family" amino acids 5 to 393 (389 residues), 293.5 bits, see alignment E=2.4e-91 PF13450: NAD_binding_8" amino acids 7 to 37 (31 residues), 24.6 bits, see alignment (E = 6.4e-09) TIGR03862: flavoprotein, TIGR03862 family" amino acids 25 to 399 (375 residues), 484.9 bits, see alignment E=1.4e-149 PF22780: HI0933_like_1st" amino acids 191 to 341 (151 residues), 85.6 bits, see alignment E=8.7e-28

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 95% identity to azl:AZL_026510)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>MPMX19_00024 3-dehydro-bile acid delta(4,6)-reductase (Azospirillum sp. SherDot2)
MTPDVAIVGAGPAGLMAAEIAAAAGLRVAVFDHTPTPARKLLLAGRGGLNLTHSEPLDRF
LPRYGAAEPLFRRLLAGFSPDDLRGWAAGLGIETFVGSSGRVFPVQMKASTLVRAWLRRL
DGLGVTLHSRHRWTGWDATGALTFRHGEETVTVAPRATLLALGGASWPRTGSDGGWVPLL
EGLGVEVAPLVPSNMGFEVPWSDHLRDRFAGQPVKSVGLSAAGRRLKGEFVITETGIEGG
AVYALSAPLRDAIAAEGWATLTLDLLPDMAEAELVKRLRRRGAESLSTFLKKSLSLTGPR
AALLREFAPAADLSDPVALARQIKGLSMVLTGVRPIERAISSAGGVRLSELDERSMLTRR
PGLFLAGEMLDWEAPTGGYLLQGCFAMGVAAGKGMVEWLGMKTPGAD