Protein Info for MPMX19_00014 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 transmembrane" amino acids 45 to 62 (18 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 489 to 509 (21 residues), see Phobius details TIGR03348: type VI secretion protein IcmF" amino acids 79 to 733 (655 residues), 528 bits, see alignment E=3e-162 PF14331: IcmF-related_N" amino acids 233 to 494 (262 residues), 250.9 bits, see alignment E=1.3e-78 PF06761: IcmF-related" amino acids 593 to 735 (143 residues), 82.7 bits, see alignment E=3.4e-27

Best Hits

Predicted SEED Role

"IcmF-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (751 amino acids)

>MPMX19_00014 hypothetical protein (Azospirillum sp. SherDot2)
MAEPPSPKAGAPAAKTAATATAKTTVRRRKPAAAPSPYRSARSRWVLSLSGVLALGLAGW
LLLPRLAASFAPHLLPSIQPDWSVRLLPLVLALAGWIAVNRRIDARERAANTRLLEVLAA
RRDPELKASLEEIGTVRKQLDAALAQLRTRRGGRYLYQLPWYLVIGAPGSGKTTALANTG
LAALSPGGKAAQPAAGPFIGLGGTRNCDWWFTDRAVLIDTAGRYTTQDSRRAVDGRVWSG
LLDLLKEHRPRQPANGVLLTVSIPELTGWTDAERRNHAILIRQRLNELRVQLGVRLPVYL
LLTKADLLDGFATFFDPLDREARGQVWGLTLPAEEPASDTSAPGSSAGPLPVFRALYAGL
VRRLDERLLDRLHQEPDIRRRSDAFALPLRVAELEPALADIVDTAFGSEHGEEAPRLRGL
YLTSATQTDASLALFHPDSGPEGGPGGGHETGGPASTYFLERLLPDVVFPEANLARVDRR
VERARRRRALLSAAAALALALAVGGWWLVSARGNAALLERADAGAAAVEAALRPLDTAPR
SLVRVDDADPAAILPALEALRALPFAFDDAQDGAGRMWAGEMWTARIWAGPALAGGLYQG
GRIAVPAQEAYRRALRTQFLARIALRLEERLRADWALPDQLRQTLRVYRMITGRTIAGQM
AGGQMAGGAEPMDAGAMAEWLALDWQRTLPGPANEARRRALGDHLAALFAVGFAPVPPDE
VLVARVLEVLAQSTPQAAPQPSSQPGRAALP