Protein Info for MIT1002_04118 in Alteromonas macleodii MIT1002

Annotation: Lipid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 73 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 70 (27 residues), see Phobius details PF00137: ATP-synt_C" amino acids 4 to 67 (64 residues), 53.1 bits, see alignment E=1.5e-18 TIGR01260: ATP synthase F0, C subunit" amino acids 14 to 70 (57 residues), 103.9 bits, see alignment E=1.7e-34

Best Hits

Swiss-Prot: 86% identical to ATPL_SHEDO: ATP synthase subunit c (atpE) from Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 100% identity to amc:MADE_04088)

MetaCyc: 62% identical to ATP synthase Fo complex subunit c (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (73 amino acids)

>MIT1002_04118 Lipid-binding protein (Alteromonas macleodii MIT1002)
MLYIAVALLIGLGALGTAIGFGLLGGKFLESAARQPELAPQLQVKMFIVAGLIDAIAMIG
VGIALYLLFAVGA