Protein Info for MIT1002_04117 in Alteromonas macleodii MIT1002

Annotation: F-type ATPase subunit b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00430: ATP-synt_B
  • amino acids 6 to 137 (132 residues), 129.7 bits, E=3.7e-42
• TIGR01144: ATP synthase F0, B subunit
  • amino acids 10 to 156 (147 residues), 176.4 bits, E=1.6e-56

Best Hits

Swiss-Prot: 80% identical to ATPF2_PSEA6: ATP synthase subunit b 2 (atpF2) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 99% identity to alt:ambt_22170)

MetaCyc: 65% identical to ATP synthase Fo complex subunit b (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase F0 sector subunit b"

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (156 amino acids)

>MIT1002_04117 F-type ATPase subunit b (Alteromonas macleodii MIT1002)
MNFNATFIGQLIAFAVFVVFCMKYVWPPLMAAIEERQKKIADGLEASERAEKDLELAQAK
ATEQLKDAKAQAAEIIEQAKKRANQLVDEETQKGHAEREKIIASGYAEIEAERNRAKEDL
RKQVSALAVAGAQQILQREIDANAQNDIVEKLVAEL