Protein Info for MIT1002_04066 in Alteromonas macleodii MIT1002

Annotation: SNARE associated Golgi protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details PF09335: VTT_dom" amino acids 53 to 159 (107 residues), 59.9 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: None (inferred from 91% identity to amc:MADE_04042)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>MIT1002_04066 SNARE associated Golgi protein (Alteromonas macleodii MIT1002)
MELGKKVKHKTKKLVDSKHMLKGITLASFLESTIVPIPLEAVMVPLMQARRESLWKIALM
ATIGCVIGAVFGYALGYYLFDMVGQWLIDTFFSQEQFDNVKQQMQNQGFWFVMTLGIAPI
PFQVAMLAAGATQYSLPLFLLATVIARSIRYFGLAAVVYYTGDKAEQLIKRYKMKAVIAI
TVAVLLLWWLSNLISQ