Protein Info for MIT1002_04056 in Alteromonas macleodii MIT1002

Annotation: Glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR01027: glutamate 5-kinase" amino acids 7 to 364 (358 residues), 395 bits, see alignment E=1.7e-122 PF00696: AA_kinase" amino acids 8 to 233 (226 residues), 132.7 bits, see alignment E=1.9e-42 PF01472: PUA" amino acids 275 to 348 (74 residues), 63.3 bits, see alignment E=1.6e-21

Best Hits

Swiss-Prot: 57% identical to PROB_IDILO: Glutamate 5-kinase (proB) from Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 94% identity to amc:MADE_04032)

MetaCyc: 41% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11)" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.11

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>MIT1002_04056 Glutamate 5-kinase (Alteromonas macleodii MIT1002)
MNRFNWQRAVIKVGSALIAPEGNECSGRYLLSLARFITASREAGKEIILVSSGSVAAGRS
KVKVRHNASIAEKQAMAAIGQNLMMANWQRFFDFPCAQVLLTADDLRDRTRYVNIKNTLR
EILNHNALPIVNENDTVAVNELKVGDNDNLGAYTALVAQADTLIICSDIDGLFTADPRKD
ASATLIPQVDKIDSTIYGLAGGAGTAVGTGGMRTKIEAADKCTSSGIQTLIVNGRKGETF
DALLEGKVPGTLFNASSTPASARRLWLTHTLKTAGRIDVDSGAKEALVRKGASLLPSGIV
DVVGLFEQGDAVEVVCQGEVIAKGLCLYNAKDLTLIKGKKSKEIASVLGYETTDVAIHRD
DMVLYS