Protein Info for MIT1002_04055 in Alteromonas macleodii MIT1002

Annotation: acyl-CoA thioester hydrolase, YbgC/YbaW family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13279: 4HBT_2
  • amino acids 20 to 137 (118 residues), 64 bits, E=1.9e-21
• PF03061: 4HBT
  • amino acids 27 to 107 (81 residues), 49.7 bits, E=3.9e-17

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 93% identity to amc:MADE_04031)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (145 amino acids)

>MIT1002_04055 acyl-CoA thioester hydrolase, YbgC/YbaW family (Alteromonas macleodii MIT1002)
MTDITPTLADYPYKVTIATRWQDNDAYGHINNVVYYGFFDTAVNRFLIEEGGLDIHNGQS
VAYVVSSQCQYIAPAAYPEDIFVGLRVIKIGRSSVTYGLSVYAGENKRRVAHGQFVHVFV
DRKTDKAIPIPVNVKTALESIVEVM