Protein Info for MIT1002_04047 in Alteromonas macleodii MIT1002

Annotation: Prolyl tripeptidyl peptidase precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF02129: Peptidase_S15" amino acids 407 to 555 (149 residues), 48.8 bits, see alignment E=4.2e-16 PF01738: DLH" amino acids 411 to 613 (203 residues), 32.3 bits, see alignment E=3.9e-11 PF20434: BD-FAE" amino acids 419 to 606 (188 residues), 34.9 bits, see alignment E=6e-12 PF00561: Abhydrolase_1" amino acids 425 to 558 (134 residues), 28.9 bits, see alignment E=4.5e-10 PF00326: Peptidase_S9" amino acids 442 to 647 (206 residues), 145.4 bits, see alignment E=8.9e-46 PF00756: Esterase" amino acids 493 to 547 (55 residues), 30.1 bits, see alignment 2.1e-10 PF03959: FSH1" amino acids 505 to 615 (111 residues), 31.2 bits, see alignment E=9e-11

Best Hits

KEGG orthology group: None (inferred from 70% identity to alt:ambt_21810)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (663 amino acids)

>MIT1002_04047 Prolyl tripeptidyl peptidase precursor (Alteromonas macleodii MIT1002)
MSSNKALLPTTLVTLLLLVCSFSTLGADQTKAEPEYEKFSSLPTYWTPSLSPDGSKIAFV
QNVEQEEAFAMLATYDLKKGEKHYLLRSDNERVKINWYNWVNNERLVVSARYETRRGTTK
VHDTRLLSIKFDGEGGAFNLVEWERIKRRAGNPNHIPQFHDDVIDWLPDDPEHILIALDA
EVLGLPSVYKINVNDGGVSRIIRGKKRIRDWMTDQQNNVRIGVSLDYDTGEREVFLKEGD
DWRTLFAYNAMSDKGEYPVGFAKDPNILYFKGYKGDFRALYTLNLTTNERTEVYADEGYD
VNGSLIYSPVTRDAIGVRHDGRHYWDERYVALQNGIDAGLPDYDNTLVSFSDDEQTYIVY
SESDTLPGVYLLGDRKEGTLVMLFEQYAQIDPAKLSEHTLIEYEARDGIKIEAYLTLPKG
EGPFPTIIHPHGGPGARDFSGFDYWTAYFSSKGYAVLRPNFRGSRGYGYSFAQSQMKGWG
LAMQDDITDAANWMVEQGHAEQDNMCIVGASYGGYAALMATVKTPDLFKCAVSFAGVSSL
KHVIIHSRRFLNNEFVKNQIGDDYDDLEARSPYYNAKGIKTPILLVHGEEDRVVPPLHSR
YMADELDDYDKVYKYVELESGDHNLSIQRNRHIFFKEMDAFLDQYLRPASKASAATANVS
ASE