Protein Info for MIT1002_04046 in Alteromonas macleodii MIT1002

Annotation: Sulfonamide resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 371 (341 residues), 114.6 bits, see alignment E=7.7e-37 PF06609: TRI12" amino acids 41 to 193 (153 residues), 27.6 bits, see alignment E=1.6e-10 PF00083: Sugar_tr" amino acids 58 to 129 (72 residues), 40.1 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 94% identity to amc:MADE_04022)

Predicted SEED Role

"MFS family multidrug efflux protein, similarity to bicyclomycin resistance protein Bcr"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>MIT1002_04046 Sulfonamide resistance protein (Alteromonas macleodii MIT1002)
MPQTSNGVSEDTAVVQKPALGLVEFVALMATMTSLVALSIDAMLPALIQIGESLQVAEAH
QTHLIVTVFFLGMALGQMFFGPFSDSRGRRLTILVGLCIFALGTFVCMMATNLETMLVGR
VIQAFGVSGPRIASMAIIRDLYVGDAMAKVMSFIMMVFILVPMLAPIIGQTVMELTSWFH
IFTMFLIVATMAGIWFFSRQGETLPRARRKKFSWAQFFASSKFILTNPAVMGYTFAMGCI
FGAFLAYLSASQTIFTVFYNVGEWFPYIFATLAFSIGLASYFNGKMVMRFGMRKLCRFAL
KGVNGFAVVYLALLLAYDGLPPLIPTVAVMFVGFFFVGILFGNLNAMAMQPLGDMAGLGA
AIIGSFSSLFSVPVALFVDSFLNGNLMPIGWGFLVFFALSYVSVRYAERVREGSI