Protein Info for MIT1002_04043 in Alteromonas macleodii MIT1002

Annotation: Competence protein ComM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 TIGR00368: Mg chelatase-like protein" amino acids 10 to 492 (483 residues), 577.8 bits, see alignment E=9.2e-178 PF13541: ChlI" amino acids 21 to 139 (119 residues), 141.8 bits, see alignment E=3e-45 PF01078: Mg_chelatase" amino acids 192 to 388 (197 residues), 283.4 bits, see alignment E=2.7e-88 PF00158: Sigma54_activat" amino acids 203 to 358 (156 residues), 31 bits, see alignment E=6.1e-11 PF00493: MCM" amino acids 206 to 382 (177 residues), 33.9 bits, see alignment E=5.6e-12 PF07728: AAA_5" amino acids 213 to 351 (139 residues), 42.2 bits, see alignment E=2.4e-14 PF13335: Mg_chelatase_C" amino acids 405 to 492 (88 residues), 92.8 bits, see alignment E=5e-30

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 81% identity to alt:ambt_21790)

Predicted SEED Role

"Dihydroxy-acid dehydratase (EC 4.2.1.9)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.2.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.9

Use Curated BLAST to search for 4.2.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>MIT1002_04043 Competence protein ComM (Alteromonas macleodii MIT1002)
MGMAVVKTFAGQGVAAPEVSVEIHLANGLPAFQLVGMAETSVKEARERVRSALINSGFEF
PAKRITVNLAPADIPKFGGRFDLPIAVGILAASGYISDISLLNIAFVGELALNGEIKPVN
GLIPLVMAAAHEDIALVYPGDNDVEAALVSHATRYPAFDLQSVYEHLAGNKKLAKGQPFT
SRALNSPLSGWDDIIGQEQAKRALVIAASGAHNLLMVGPPGTGKSLLASRMLSLLPDMSE
EEALEVAAIHSVKGEKLHAERFLTRHLRSPHHTSSAVALTGGGSNPVPGEISLAHNGILF
LDELPEFGRKALDVLREPLETGDVHLSRASGSATYPANFQLVAAMNPSPTGDIDDNRLTP
QQQLNYLNRLSGPLLDRIDIQVEVPRLPDYDLPERANRPDDSLHATRERVIAARHKQGLR
QGKPNGALHAGELADICLLDDADLQFLQAAAKQLNLSMRVFHRTLKVARTIADLEEENTV
SRAHIAEALGYRALDNLIKQLSAS