Protein Info for MIT1002_04042 in Alteromonas macleodii MIT1002

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 7 to 78 (72 residues), 78.4 bits, see alignment E=1.6e-26 amino acids 93 to 163 (71 residues), 70.1 bits, see alignment E=5.8e-24

Best Hits

Swiss-Prot: 45% identical to Y2382_VIBCH: UPF0126 membrane protein VC_2382 (VC_2382) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 85% identity to alt:ambt_21785)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>MIT1002_04042 putative membrane protein (Alteromonas macleodii MIT1002)
MFDWFHWLNLAGVAVCAISGTLMAYQKRMDGFGVVVLASATAIGGGTLRDVMLDVPVFWI
ADTDYLYTTLIAAFIPIIWLRISPRFPFHYLLIADAFGLALFNVVGIEKALANDTGMAVA
VAMGTITGVFGGLLRDVICREVPLVLNGELYAMTCIAGGVVYGIGMQMELATQWCGIAAL
VTTVLFRLGAMRWHWQLPVFYNDHH